![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins) |
![]() | Protein beta-Galactosidase [49804] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [49805] (46 PDB entries) Uniprot P00722 |
![]() | Domain d1jz2b3: 1jz2 B:13-219 [67717] Other proteins in same PDB: d1jz2a1, d1jz2a2, d1jz2a4, d1jz2a5, d1jz2b1, d1jz2b2, d1jz2b4, d1jz2b5, d1jz2c1, d1jz2c2, d1jz2c4, d1jz2c5, d1jz2d1, d1jz2d2, d1jz2d4, d1jz2d5 complexed with 2fg, btb, dms, mg, na |
PDB Entry: 1jz2 (more details), 2.1 Å
SCOPe Domain Sequences for d1jz2b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jz2b3 b.18.1.5 (B:13-219) beta-Galactosidase {Escherichia coli [TaxId: 562]} rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws dgsyledqdmwrmsgifrdvsllhkpt
Timeline for d1jz2b3:
![]() Domains from same chain: (mouse over for more information) d1jz2b1, d1jz2b2, d1jz2b4, d1jz2b5 |