Lineage for d1jz0h2 (1jz0 H:626-730)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2372434Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2372435Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 2372436Protein beta-Galactosidase, domains 2 and 4 [49305] (3 species)
  7. 2372450Species Escherichia coli [TaxId:562] [49306] (45 PDB entries)
    Uniprot P00722
  8. 2372818Domain d1jz0h2: 1jz0 H:626-730 [67666]
    Other proteins in same PDB: d1jz0a3, d1jz0a4, d1jz0a5, d1jz0b3, d1jz0b4, d1jz0b5, d1jz0c3, d1jz0c4, d1jz0c5, d1jz0d3, d1jz0d4, d1jz0d5, d1jz0e3, d1jz0e4, d1jz0e5, d1jz0f3, d1jz0f4, d1jz0f5, d1jz0g3, d1jz0g4, d1jz0g5, d1jz0h3, d1jz0h4, d1jz0h5
    complexed with 2fg, mg, na
    complexed with 2fg, mg, na

Details for d1jz0h2

PDB Entry: 1jz0 (more details), 2.6 Å

PDB Description: e. coli (lacz) beta-galactosidase-trapped 2-f-galactosyl-enzyme intermediate. chains a-h, see remark 400
PDB Compounds: (H:) beta-galactosidase

SCOPe Domain Sequences for d1jz0h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz0h2 b.1.4.1 (H:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

SCOPe Domain Coordinates for d1jz0h2:

Click to download the PDB-style file with coordinates for d1jz0h2.
(The format of our PDB-style files is described here.)

Timeline for d1jz0h2: