Lineage for d1jz0g3 (1jz0 G:3-219)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774233Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 2774234Protein beta-Galactosidase [49804] (3 species)
  7. 2774242Species Escherichia coli [TaxId:562] [49805] (46 PDB entries)
    Uniprot P00722
  8. 2774413Domain d1jz0g3: 1jz0 G:3-219 [67662]
    Other proteins in same PDB: d1jz0a1, d1jz0a2, d1jz0a4, d1jz0a5, d1jz0b1, d1jz0b2, d1jz0b4, d1jz0b5, d1jz0c1, d1jz0c2, d1jz0c4, d1jz0c5, d1jz0d1, d1jz0d2, d1jz0d4, d1jz0d5, d1jz0e1, d1jz0e2, d1jz0e4, d1jz0e5, d1jz0f1, d1jz0f2, d1jz0f4, d1jz0f5, d1jz0g1, d1jz0g2, d1jz0g4, d1jz0g5, d1jz0h1, d1jz0h2, d1jz0h4, d1jz0h5
    complexed with 2fg, mg, na
    complexed with 2fg, mg, na

Details for d1jz0g3

PDB Entry: 1jz0 (more details), 2.6 Å

PDB Description: e. coli (lacz) beta-galactosidase-trapped 2-f-galactosyl-enzyme intermediate. chains a-h, see remark 400
PDB Compounds: (G:) beta-galactosidase

SCOPe Domain Sequences for d1jz0g3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz0g3 b.18.1.5 (G:3-219) beta-Galactosidase {Escherichia coli [TaxId: 562]}
itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d1jz0g3:

Click to download the PDB-style file with coordinates for d1jz0g3.
(The format of our PDB-style files is described here.)

Timeline for d1jz0g3: