| Class b: All beta proteins [48724] (178 folds) |
| Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) ![]() probable carbohydrate-binding domain in enzymes acting on sugars |
| Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein) automatically mapped to Pfam PF02929 |
| Protein beta-Galactosidase, domain 5 [49996] (3 species) |
| Species Escherichia coli [TaxId:562] [49997] (45 PDB entries) Uniprot P00722 |
| Domain d1jyvd4: 1jyv D:731-1023 [67508] Other proteins in same PDB: d1jyva1, d1jyva2, d1jyva3, d1jyva5, d1jyvb1, d1jyvb2, d1jyvb3, d1jyvb5, d1jyvc1, d1jyvc2, d1jyvc3, d1jyvc5, d1jyvd1, d1jyvd2, d1jyvd3, d1jyvd5 complexed with 145, dms, mg, na |
PDB Entry: 1jyv (more details), 1.75 Å
SCOPe Domain Sequences for d1jyvd4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jyvd4 b.30.5.1 (D:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
Timeline for d1jyvd4:
View in 3DDomains from same chain: (mouse over for more information) d1jyvd1, d1jyvd2, d1jyvd3, d1jyvd5 |