Lineage for d1jyvb2 (1jyv B:626-730)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1521823Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 1521824Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 1521825Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species)
  7. 1521839Species Escherichia coli [TaxId:562] [49306] (41 PDB entries)
    Uniprot P00722
  8. 1521923Domain d1jyvb2: 1jyv B:626-730 [67496]
    Other proteins in same PDB: d1jyva3, d1jyva4, d1jyva5, d1jyvb3, d1jyvb4, d1jyvb5, d1jyvc3, d1jyvc4, d1jyvc5, d1jyvd3, d1jyvd4, d1jyvd5
    complexed with 145, dms, mg, na

Details for d1jyvb2

PDB Entry: 1jyv (more details), 1.75 Å

PDB Description: e. coli (lacz) beta-galactosidase (e537q) in complex with onpg
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d1jyvb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jyvb2 b.1.4.1 (B:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

SCOPe Domain Coordinates for d1jyvb2:

Click to download the PDB-style file with coordinates for d1jyvb2.
(The format of our PDB-style files is described here.)

Timeline for d1jyvb2: