Lineage for d1jy3p_ (1jy3 P:)

  1. Root: SCOP 1.75
  2. 894739Class h: Coiled coil proteins [57942] (7 folds)
  3. 894740Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 895301Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) (S)
  5. 895302Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 895414Protein Fibrinogen gamma chain [88898] (4 species)
  7. 895418Species Cow (Bos taurus) [TaxId:9913] [88901] (2 PDB entries)
  8. 895421Domain d1jy3p_: 1jy3 P: [67448]
    Other proteins in same PDB: d1jy3n_, d1jy3o_, d1jy3q_, d1jy3r_
    central region only (e5 fragment)

Details for d1jy3p_

PDB Entry: 1jy3 (more details), 1.6 Å

PDB Description: crystal structure of the central region of bovine fibrinogen (e5 fragment) at 1.4 angstroms resolution
PDB Compounds: (P:) fibrinogen gamma-b chain

SCOP Domain Sequences for d1jy3p_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jy3p_ h.1.8.1 (P:) Fibrinogen gamma chain {Cow (Bos taurus) [TaxId: 9913]}
vatrdnccilderfgsycpttcgiadflnnyqtsvdkdlrtlegil

SCOP Domain Coordinates for d1jy3p_:

Click to download the PDB-style file with coordinates for d1jy3p_.
(The format of our PDB-style files is described here.)

Timeline for d1jy3p_: