Lineage for d1jy3p_ (1jy3 P:)

  1. Root: SCOP 1.61
  2. 205390Class h: Coiled coil proteins [57942] (5 folds)
  3. 205391Fold h.1: Parallel coiled-coil [57943] (22 superfamilies)
  4. 205752Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) (S)
  5. 205753Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (1 protein)
  6. 205754Protein Fibrinogen coiled-coil and central regions [58012] (4 species)
  7. 205762Species Cow (Bos taurus) [TaxId:9913] [69977] (2 PDB entries)
  8. 205771Domain d1jy3p_: 1jy3 P: [67448]

Details for d1jy3p_

PDB Entry: 1jy3 (more details), 1.6 Å

PDB Description: crystal structure of the central region of bovine fibrinogen (e5 fragment) at 1.4 angstroms resolution

SCOP Domain Sequences for d1jy3p_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jy3p_ h.1.8.1 (P:) Fibrinogen coiled-coil and central regions {Cow (Bos taurus)}
vatrdnccilderfgsycpttcgiadflnnyqtsvdkdlrtlegil

SCOP Domain Coordinates for d1jy3p_:

Click to download the PDB-style file with coordinates for d1jy3p_.
(The format of our PDB-style files is described here.)

Timeline for d1jy3p_: