Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (34 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) |
Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins) in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails |
Protein Fibrinogen gamma chain [88898] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [88901] (2 PDB entries) |
Domain d1jy2p_: 1jy2 P: [67442] Other proteins in same PDB: d1jy2n_, d1jy2o_, d1jy2q_, d1jy2r_ central region only (e5 fragment) |
PDB Entry: 1jy2 (more details), 1.4 Å
SCOP Domain Sequences for d1jy2p_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jy2p_ h.1.8.1 (P:) Fibrinogen gamma chain {Cow (Bos taurus) [TaxId: 9913]} rdnccilderfgsycpttcgiadflnnyqtsvdkdlrtlegily
Timeline for d1jy2p_: