Lineage for d1jxob1 (1jxo B:430-525)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 461193Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 461236Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 461237Family b.34.2.1: SH3-domain [50045] (35 proteins)
  6. 461472Protein Psd-95 [69248] (1 species)
    associates with a guanylate kinase domain
  7. 461473Species Rat (Rattus norvegicus) [TaxId:10116] [69249] (3 PDB entries)
  8. 461477Domain d1jxob1: 1jxo B:430-525 [67424]
    Other proteins in same PDB: d1jxoa2, d1jxob2

Details for d1jxob1

PDB Entry: 1jxo (more details), 2.3 Å

PDB Description: crystal structure of the sh3-hook-gk fragment of psd-95

SCOP Domain Sequences for d1jxob1:

Sequence, based on SEQRES records: (download)

>d1jxob1 b.34.2.1 (B:430-525) Psd-95 {Rat (Rattus norvegicus)}
gfyiralfdydktkdcgflsqalsfrfgdvlhvidagdeewwqarrvhsdsetddigfip
skrrverrewsrlkakdwgsssgsqgredsvlsyet

Sequence, based on observed residues (ATOM records): (download)

>d1jxob1 b.34.2.1 (B:430-525) Psd-95 {Rat (Rattus norvegicus)}
gfyiralfdydktkdcgflsqalsfrfgdvlhvidagdeewwqarrvhigfipskrrver
rewsrlkakdwgvlsyet

SCOP Domain Coordinates for d1jxob1:

Click to download the PDB-style file with coordinates for d1jxob1.
(The format of our PDB-style files is described here.)

Timeline for d1jxob1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jxob2