SCOPe 2.08: Domain d1jxob1: 1jxo B:430-525

Lineage for d1jxob1 (1jxo B:430-525)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein Psd-95 [69248] (1 species)
   associates with a guanylate kinase domain

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [69249] (3 PDB entries)

8. Domain d1jxob1: 1jxo B:430-525 [67424]
   Other proteins in same PDB: d1jxoa2, d1jxob2
   has additional insertions and/or extensions that are not grouped together

Details for d1jxob1

PDB Entry: 1jxo, 2.3 Å

PDB Description: crystal structure of the sh3-hook-gk fragment of psd-95

PDB Compounds: (B:) postsynaptic density protein

SCOPe Domain Sequences for d1jxob1:

Sequence, based on SEQRES records:

>d1jxob1 b.34.2.1 (B:430-525) Psd-95 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gfyiralfdydktkdcgflsqalsfrfgdvlhvidagdeewwqarrvhsdsetddigfip
skrrverrewsrlkakdwgsssgsqgredsvlsyet

Sequence, based on observed residues (ATOM records):

>d1jxob1 b.34.2.1 (B:430-525) Psd-95 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gfyiralfdydktkdcgflsqalsfrfgdvlhvidagdeewwqarrvhigfipskrrver
rewsrlkakdwgvlsyet

Timeline for d1jxob1:

• d1jxob1 first appeared in SCOP 1.59
  
• d1jxob1 appears in SCOPe 2.07