SCOPe 2.06: Domain d1jxac2: 1jxa C:1-240

Lineage for d1jxac2 (1jxa C:1-240)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.1: Class II glutamine amidotransferases [56236] (6 proteins)
   has slightly different topology than other families do

6. Protein Glucosamine 6-phosphate synthase, N-terminal domain [56237] (1 species)

7. Species Escherichia coli [TaxId:562] [56238] (7 PDB entries)
   Uniprot P17169 1-238

8. Domain d1jxac2: 1jxa C:1-240 [67412]
   Other proteins in same PDB: d1jxaa1, d1jxab1, d1jxac1
   complexed with g6q

Details for d1jxac2

PDB Entry: 1jxa, 3.1 Å

PDB Description: glucosamine 6-phosphate synthase with glucose 6-phosphate

PDB Compounds: (C:) glucosamine 6-phosphate synthase

SCOPe Domain Sequences for d1jxac2:

Sequence; same for both SEQRES and ATOM records:

>d1jxac2 d.153.1.1 (C:1-240) Glucosamine 6-phosphate synthase, N-terminal domain {Escherichia coli [TaxId: 562]}
cgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee
hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs
etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi
glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnlqy

Timeline for d1jxac2:

• d1jxac2 first appeared in SCOP 1.59
  
• d1jxac2 appears in SCOPe 2.05
  
• d1jxac2 appears in SCOPe 2.07
  
• d1jxac2 appears in the current release, SCOPe 2.08