Class a: All alpha proteins [46456] (290 folds) |
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) |
Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (4 proteins) lacks the first helix of canonical fold 3 helices; bundle, partly opened, right-handed twist |
Protein Lac repressor (LacR), N-terminal domain [47441] (1 species) |
Species Escherichia coli [TaxId:562] [47442] (14 PDB entries) |
Domain d1jwlb1: 1jwl B:2-60 [67391] Other proteins in same PDB: d1jwla2, d1jwlb2, d1jwlc_ protein/DNA complex; complexed with npf |
PDB Entry: 1jwl (more details), 4 Å
SCOPe Domain Sequences for d1jwlb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jwlb1 a.35.1.5 (B:2-60) Lac repressor (LacR), N-terminal domain {Escherichia coli [TaxId: 562]} kpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkq
Timeline for d1jwlb1: