Lineage for d1jwla2 (1jwl A:61-330)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 593209Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 593210Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 593211Family c.93.1.1: L-arabinose binding protein-like [53823] (15 proteins)
  6. 593295Protein Lac-repressor (lacR) core (C-terminal domain) [53837] (1 species)
  7. 593296Species Escherichia coli [TaxId:562] [53838] (8 PDB entries)
  8. 593314Domain d1jwla2: 1jwl A:61-330 [67390]
    Other proteins in same PDB: d1jwla1, d1jwlb1

Details for d1jwla2

PDB Entry: 1jwl (more details), 4 Å

PDB Description: structure of the dimeric lac repressor/operator o1/onpf complex

SCOP Domain Sequences for d1jwla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jwla2 c.93.1.1 (A:61-330) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli}
slligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvs
gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
vdrllqlsqgqavkgnqllpvslvkrkttl

SCOP Domain Coordinates for d1jwla2:

Click to download the PDB-style file with coordinates for d1jwla2.
(The format of our PDB-style files is described here.)

Timeline for d1jwla2: