SCOP 1.59: Domain d1jwla2: 1jwl A:61-330

Lineage for d1jwla2 (1jwl A:61-330)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family)

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (13 proteins)

6. Protein Lac-repressor (lacR) core (C-terminal domain) [53837] (1 species)

7. Species Escherichia coli [TaxId:562] [53838] (8 PDB entries)

8. Domain d1jwla2: 1jwl A:61-330 [67390]
   Other proteins in same PDB: d1jwla1, d1jwlb1

Details for d1jwla2

PDB Entry: 1jwl, 4 Å

PDB Description: structure of the dimeric lac repressor/operator o1/onpf complex

SCOP Domain Sequences for d1jwla2:

Sequence; same for both SEQRES and ATOM records:

>d1jwla2 c.93.1.1 (A:61-330) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli}
slligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvs
gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
vdrllqlsqgqavkgnqllpvslvkrkttl

Timeline for d1jwla2:

• d1jwla2 is new in SCOP 1.59
  
• d1jwla2 appears in SCOP 1.61
  
• d1jwla2 appears in the current release, SCOPe 2.08