SCOP 1.69: Domain d1jv7a_: 1jv7 A:

Lineage for d1jv7a_ (1jv7 A:)

1. Root: SCOP 1.69

2. Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)

3. Fold f.13: Family A G protein-coupled receptor-like [81322] (1 superfamily)
   core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane

4. Superfamily f.13.1: Family A G protein-coupled receptor-like [81321] (2 families)

5. Family f.13.1.1: Bacteriorhodopsin-like [81319] (4 proteins)

6. Protein Bacteriorhodopsin [56871] (2 species)
   a light-driven proton pump

7. Species Archaeon Halobacterium salinarum [TaxId:2242] [56873] (52 PDB entries)

8. Domain d1jv7a_: 1jv7 A: [67347]

Details for d1jv7a_

PDB Entry: 1jv7, 2.25 Å

PDB Description: bacteriorhodopsin o-like intermediate state of the d85s mutant at 2.25 angstrom resolution

SCOP Domain Sequences for d1jv7a_:

Sequence, based on SEQRES records:

>d1jv7a_ f.13.1.1 (A:) Bacteriorhodopsin {Archaeon Halobacterium salinarum}
ewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgygltm
vpfggeqnpiywaryaswlfttplllldlallvdadqgtilalvgadgimigtglvgalt
kvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsaypvv
wligsegagivplnietllfmvldvsakvgfglillrsraifge

Sequence, based on observed residues (ATOM records):

>d1jv7a_ f.13.1.1 (A:) Bacteriorhodopsin {Archaeon Halobacterium salinarum}
ewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgiywar
yaswlfttplllldlallvdadqgtilalvgadgimigtglvgaltkvysyrfvwwaist
aamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsaypvvwligsegagivpln
ietllfmvldvsakvgfglillrsraifge

Timeline for d1jv7a_:

• d1jv7a_ first appeared in SCOP 1.59
  
• d1jv7a_ appears in SCOP 1.67
  
• d1jv7a_ appears in SCOP 1.71
  
• d1jv7a_ appears in the current release, SCOPe 2.08