Lineage for d1jusa1 (1jus A:2-72)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305223Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2305653Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. 2305738Protein Multidrug binding protein QacR [68964] (1 species)
  7. 2305739Species Staphylococcus aureus [TaxId:1280] [68965] (24 PDB entries)
    Uniprot P23217
  8. 2305774Domain d1jusa1: 1jus A:2-72 [67326]
    Other proteins in same PDB: d1jusa2, d1jusb2, d1jusd2, d1juse2
    complexed with rhq, so4

Details for d1jusa1

PDB Entry: 1jus (more details), 2.84 Å

PDB Description: crystal structure of the multidrug binding transcriptional repressor qacr bound to rhodamine 6g
PDB Compounds: (A:) hypothetical transcriptional regulator in qaca 5'region

SCOPe Domain Sequences for d1jusa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jusa1 a.4.1.9 (A:2-72) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
qeqwkkeqika

SCOPe Domain Coordinates for d1jusa1:

Click to download the PDB-style file with coordinates for d1jusa1.
(The format of our PDB-style files is described here.)

Timeline for d1jusa1: