Lineage for d1jupb1 (1jup B:2-72)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1257872Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1258262Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. 1258295Protein Multidrug binding protein QacR [68964] (1 species)
  7. 1258296Species Staphylococcus aureus [TaxId:1280] [68965] (24 PDB entries)
    Uniprot P23217
  8. 1258380Domain d1jupb1: 1jup B:2-72 [67316]
    Other proteins in same PDB: d1jupa2, d1jupb2, d1jupd2, d1jupe2
    complexed with mgr, so4

Details for d1jupb1

PDB Entry: 1jup (more details), 2.95 Å

PDB Description: crystal structure of the multidrug binding transcriptional repressor qacr bound to malachite green
PDB Compounds: (B:) hypothetical transcriptional regulator in qaca 5'region

SCOPe Domain Sequences for d1jupb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jupb1 a.4.1.9 (B:2-72) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
qeqwkkeqika

SCOPe Domain Coordinates for d1jupb1:

Click to download the PDB-style file with coordinates for d1jupb1.
(The format of our PDB-style files is described here.)

Timeline for d1jupb1: