Lineage for d1jupb1 (1jup B:2-72)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 94900Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 94901Superfamily a.4.1: Homeodomain-like [46689] (10 families) (S)
  5. 95108Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (2 proteins)
  6. 95109Protein Multidrug binding protein QacR [68964] (1 species)
  7. 95110Species Staphylococcus aureus [TaxId:1280] [68965] (6 PDB entries)
  8. 95132Domain d1jupb1: 1jup B:2-72 [67316]
    Other proteins in same PDB: d1jupa2, d1jupb2, d1jupd2, d1jupe2

Details for d1jupb1

PDB Entry: 1jup (more details), 2.95 Å

PDB Description: crystal structure of the multidrug binding transcriptional repressor qacr bound to malachite green
PDB Compounds: (B:)

SCOP Domain Sequences for d1jupb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jupb1 a.4.1.9 (B:2-72) Multidrug binding protein QacR {Staphylococcus aureus}
nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
qeqwkkeqika

SCOP Domain Coordinates for d1jupb1:

Click to download the PDB-style file with coordinates for d1jupb1.
(The format of our PDB-style files is described here.)

Timeline for d1jupb1: