SCOP 1.59: Domain d1jupb1: 1jup B:2-72

Lineage for d1jupb1 (1jup B:2-72)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)

4. Superfamily a.4.1: Homeodomain-like [46689] (10 families)

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (2 proteins)

6. Protein Multidrug binding protein QacR [68964] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [68965] (6 PDB entries)

8. Domain d1jupb1: 1jup B:2-72 [67316]
   Other proteins in same PDB: d1jupa2, d1jupb2, d1jupd2, d1jupe2

Details for d1jupb1

PDB Entry: 1jup, 2.95 Å

PDB Description: crystal structure of the multidrug binding transcriptional repressor qacr bound to malachite green

SCOP Domain Sequences for d1jupb1:

Sequence; same for both SEQRES and ATOM records:

>d1jupb1 a.4.1.9 (B:2-72) Multidrug binding protein QacR {Staphylococcus aureus}
nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
qeqwkkeqika

Timeline for d1jupb1:

• d1jupb1 is new in SCOP 1.59
  
• d1jupb1 appears in SCOP 1.61
  
• d1jupb1 appears in the current release, SCOPe 2.08