Class a: All alpha proteins [46456] (284 folds) |
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) |
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (34 proteins) |
Protein Multidrug binding protein QacR [69107] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [69108] (20 PDB entries) Uniprot P23217 |
Domain d1jupa2: 1jup A:73-187 [67315] Other proteins in same PDB: d1jupa1, d1jupb1, d1jupd1, d1jupe1 complexed with mgr, so4 |
PDB Entry: 1jup (more details), 2.95 Å
SCOPe Domain Sequences for d1jupa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jupa2 a.121.1.1 (A:73-187) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]} ktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklenkyidayhvifk egnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqiflngls
Timeline for d1jupa2: