Lineage for d1juoa_ (1juo A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1087624Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1087625Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1088597Family a.39.1.8: Penta-EF-hand proteins [63550] (6 proteins)
  6. 1088650Protein Sorcin [69023] (2 species)
  7. 1088656Species Human (Homo sapiens) [TaxId:9606] [69024] (1 PDB entry)
  8. 1088657Domain d1juoa_: 1juo A: [67312]

Details for d1juoa_

PDB Entry: 1juo (more details), 2.2 Å

PDB Description: Crystal Structure of Calcium-free Human Sorcin: A Member of the Penta-EF-Hand Protein Family
PDB Compounds: (A:) sorcin

SCOPe Domain Sequences for d1juoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]}
fpgqtqdplygyfaavagqdgqidadelqrcltqsgiaggykpfnletcrlmvsmldrdm
sgtmgfnefkelwavlngwrqhfisfdtdrsgtvdpqelqkalttmgfrlspqavnsiak
rystngkitfddyiaccvklraltdsfrrrdtaqqgvvnfpyddfiqcvmsv

SCOPe Domain Coordinates for d1juoa_:

Click to download the PDB-style file with coordinates for d1juoa_.
(The format of our PDB-style files is described here.)

Timeline for d1juoa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1juob_