SCOP 1.67: Domain d1jumb2: 1jum B:73-187

Lineage for d1jumb2 (1jum B:73-187)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (5 proteins)

6. Protein Multidrug binding protein QacR [69107] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [69108] (7 PDB entries)

8. Domain d1jumb2: 1jum B:73-187 [67307]
   Other proteins in same PDB: d1juma1, d1jumb1, d1jumd1, d1jume1

Details for d1jumb2

PDB Entry: 1jum, 2.98 Å

PDB Description: crystal structure of the multidrug binding transcriptional repressor qacr bound to the natural drug berberine

SCOP Domain Sequences for d1jumb2:

Sequence; same for both SEQRES and ATOM records:

>d1jumb2 a.121.1.1 (B:73-187) Multidrug binding protein QacR {Staphylococcus aureus}
ktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklenkyidayhvifk
egnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqiflngls

Timeline for d1jumb2:

• d1jumb2 first appeared in SCOP 1.59
  
• d1jumb2 appears in SCOP 1.65
  
• d1jumb2 appears in SCOP 1.69
  
• d1jumb2 appears in the current release, SCOPe 2.08