![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
![]() | Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) ![]() |
![]() | Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (34 proteins) |
![]() | Protein Multidrug binding protein QacR [69107] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [69108] (20 PDB entries) Uniprot P23217 |
![]() | Domain d1jtxb2: 1jtx B:73-187 [67287] Other proteins in same PDB: d1jtxa1, d1jtxb1, d1jtxd1, d1jtxe1 complexed with cvi, so4 |
PDB Entry: 1jtx (more details), 2.85 Å
SCOPe Domain Sequences for d1jtxb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jtxb2 a.121.1.1 (B:73-187) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]} ktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklenkyidayhvifk egnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqiflngls
Timeline for d1jtxb2: