Lineage for d1jtxb2 (1jtx B:73-187)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 923028Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 923029Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) (S)
  5. 923030Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (34 proteins)
  6. 923059Protein Multidrug binding protein QacR [69107] (1 species)
  7. 923060Species Staphylococcus aureus [TaxId:1280] [69108] (20 PDB entries)
    Uniprot P23217
  8. 923094Domain d1jtxb2: 1jtx B:73-187 [67287]
    Other proteins in same PDB: d1jtxa1, d1jtxb1, d1jtxd1, d1jtxe1
    complexed with cvi, so4

Details for d1jtxb2

PDB Entry: 1jtx (more details), 2.85 Å

PDB Description: crystal structure of the multidrug binding transcriptional regulator qacr bound to crystal violet
PDB Compounds: (B:) hypothetical transcriptional regulator in qaca 5'region

SCOPe Domain Sequences for d1jtxb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jtxb2 a.121.1.1 (B:73-187) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
ktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklenkyidayhvifk
egnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqiflngls

SCOPe Domain Coordinates for d1jtxb2:

Click to download the PDB-style file with coordinates for d1jtxb2.
(The format of our PDB-style files is described here.)

Timeline for d1jtxb2: