Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) consists only of helices |
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (34 proteins) |
Protein Multidrug binding protein QacR [68964] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [68965] (20 PDB entries) Uniprot P23217 |
Domain d1jtxa1: 1jtx A:2-72 [67284] Other proteins in same PDB: d1jtxa2, d1jtxb2, d1jtxd2, d1jtxe2 complexed with cvi, so4 |
PDB Entry: 1jtx (more details), 2.85 Å
SCOPe Domain Sequences for d1jtxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jtxa1 a.4.1.9 (A:2-72) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]} nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw qeqwkkeqika
Timeline for d1jtxa1: