SCOP 1.69: Domain d1jtoa_: 1jto A:

Lineage for d1jtoa_ (1jto A:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Camelid IG heavy chain variable domain, VHh [88563] (2 species)

7. Species Camel (Camelus dromedarius) [TaxId:9838] [88564] (13 PDB entries)

8. Domain d1jtoa_: 1jto A: [67274]
   Other proteins in same PDB: d1jtol_, d1jtom_

Details for d1jtoa_

PDB Entry: 1jto, 2.5 Å

PDB Description: degenerate interfaces in antigen-antibody complexes

SCOP Domain Sequences for d1jtoa_:

Sequence; same for both SEQRES and ATOM records:

>d1jtoa_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius)}
vqlqasgggsvqaggslrlscaasgytigpycmgwfrqapgkeregvaainmgggityya
dsvkgrftisqdnakntvyllmnslepedtaiyycaadstiyasyyecghglstggygyd
swgqgtqvtvss

Timeline for d1jtoa_:

• d1jtoa_ first appeared in SCOP 1.59
  
• d1jtoa_ appears in SCOP 1.67
  
• d1jtoa_ appears in SCOP 1.71
  
• d1jtoa_ appears in the current release, SCOPe 2.08