Lineage for d1jrxa2 (1jrx A:103-359,A:506-568)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1154265Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 1154266Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families) (S)
  5. 1154657Family c.3.1.4: Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain [51934] (5 proteins)
  6. 1154664Protein Flavocytochrome c3 (respiratory fumarate reductase) [51940] (2 species)
    contains additional N-terminal multiheme domain
  7. 1154665Species Shewanella frigidimarina [TaxId:56812] [51941] (16 PDB entries)
  8. 1154683Domain d1jrxa2: 1jrx A:103-359,A:506-568 [67194]
    Other proteins in same PDB: d1jrxa1, d1jrxa3, d1jrxb1, d1jrxb3
    complexed with fad, fum, hem, na; mutant

Details for d1jrxa2

PDB Entry: 1jrx (more details), 2 Å

PDB Description: crystal structure of arg402ala mutant flavocytochrome c3 from shewanella frigidimarina
PDB Compounds: (A:) flavocytochrome c

SCOPe Domain Sequences for d1jrxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrxa2 c.3.1.4 (A:103-359,A:506-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]}
ptiaelakdkserqaalasaphdtvdvvvvgsggagfsaaisatdsgakviliekepvig
gnaklaaggmnaawtdqqkakkitdspelmfedtmkggqnindpalvkvlsshskdsvdw
mtamgadltdvgmmggasvnrahrptggagvgahvvqvlydnavkrnidlrmntrgievl
kddkgtvkgilvkgmykgyywvkadavilatggfaknnervakldpslkgfistnqpgav
gdgldvaenaggalkdmXtmggvmidtkaevmnakkqvipglygagevtggvhganrlgg
naisdiitfgrlageeaakys

SCOPe Domain Coordinates for d1jrxa2:

Click to download the PDB-style file with coordinates for d1jrxa2.
(The format of our PDB-style files is described here.)

Timeline for d1jrxa2: