| Class b: All beta proteins [48724] (165 folds) |
| Fold b.38: Sm-like fold [50181] (3 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (5 families) ![]() |
| Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins) forms homo and heteroheptameric ring structures |
| Protein Archaeal homoheptameric Sm protein [63758] (6 species) |
| Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [63759] (5 PDB entries) MTH649, smap1 |
| Domain d1jrif_: 1jri F: [67126] |
PDB Entry: 1jri (more details), 2.8 Å
SCOP Domain Sequences for d1jrif_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jrif_ b.38.1.1 (F:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}
vqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgtvl
irgdnivyisrgk
Timeline for d1jrif_: