Lineage for d1jrif_ (1jri F:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 666911Fold b.38: Sm-like fold [50181] (3 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 666912Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (5 families) (S)
  5. 666913Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins)
    forms homo and heteroheptameric ring structures
  6. 666914Protein Archaeal homoheptameric Sm protein [63758] (6 species)
  7. 666960Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [63759] (5 PDB entries)
    MTH649, smap1
  8. 667001Domain d1jrif_: 1jri F: [67126]

Details for d1jrif_

PDB Entry: 1jri (more details), 2.8 Å

PDB Description: the crystal structure of an sm-like archaeal protein with two heptamers in the asymmetric unit.
PDB Compounds: (F:) Sm-like Archaeal Protein 1 (SmAP1)

SCOP Domain Sequences for d1jrif_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrif_ b.38.1.1 (F:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}
vqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgtvl
irgdnivyisrgk

SCOP Domain Coordinates for d1jrif_:

Click to download the PDB-style file with coordinates for d1jrif_.
(The format of our PDB-style files is described here.)

Timeline for d1jrif_: