Lineage for d1jrac_ (1jra C:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 151228Fold a.24: Four-helical up-and-down bundle [47161] (14 superfamilies)
  4. 151489Superfamily a.24.15: Thiol oxidase Erv2p [69000] (1 family) (S)
  5. 151490Family a.24.15.1: Thiol oxidase Erv2p [69001] (1 protein)
  6. 151491Protein Thiol oxidase Erv2p [69002] (1 species)
  7. 151492Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [69003] (2 PDB entries)
  8. 151497Domain d1jrac_: 1jra C: [67119]

Details for d1jrac_

PDB Entry: 1jra (more details), 2 Å

PDB Description: Crystal Structure of Erv2p

SCOP Domain Sequences for d1jrac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrac_ a.24.15.1 (C:) Thiol oxidase Erv2p {Baker's yeast (Saccharomyces cerevisiae)}
ddkvkkevgraswkyfhtllarfpdeptpeereklhtfiglyaelypcgecsyhfvklie
kypvqtssrtaaamwgchihnkvneylkkdiydcatiledydcgc

SCOP Domain Coordinates for d1jrac_:

Click to download the PDB-style file with coordinates for d1jrac_.
(The format of our PDB-style files is described here.)

Timeline for d1jrac_: