Lineage for d1jraa_ (1jra A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 440553Fold a.24: Four-helical up-and-down bundle [47161] (23 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 440880Superfamily a.24.15: FAD-dependent thiol oxidase [69000] (1 family) (S)
  5. 440881Family a.24.15.1: FAD-dependent thiol oxidase [69001] (2 proteins)
  6. 440888Protein Thiol oxidase Erv2p [69002] (1 species)
  7. 440889Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [69003] (2 PDB entries)
  8. 440892Domain d1jraa_: 1jra A: [67117]

Details for d1jraa_

PDB Entry: 1jra (more details), 2 Å

PDB Description: Crystal Structure of Erv2p

SCOP Domain Sequences for d1jraa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jraa_ a.24.15.1 (A:) Thiol oxidase Erv2p {Baker's yeast (Saccharomyces cerevisiae)}
ddkvkkevgraswkyfhtllarfpdeptpeereklhtfiglyaelypcgecsyhfvklie
kypvqtssrtaaamwgchihnkvneylkkdiydcatiledydcgcs

SCOP Domain Coordinates for d1jraa_:

Click to download the PDB-style file with coordinates for d1jraa_.
(The format of our PDB-style files is described here.)

Timeline for d1jraa_: