SCOPe 2.08: Domain d1jqza1: 1jqz A:1G-137

Lineage for d1jqza1 (1jqz A:1G-137)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)

6. Protein Acidic FGF (FGF1) [50357] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50359] (94 PDB entries)
   Uniprot P05230 16-152 ! Uniprot P05230

8. Domain d1jqza1: 1jqz A:1G-137 [67109]
   Other proteins in same PDB: d1jqza2, d1jqzb2
   complexed with fmt

Details for d1jqza1

PDB Entry: 1jqz, 1.65 Å

PDB Description: Human Acidic Fibroblast Growth Factor. 141 Amino Acid Form with Amino Terminal His Tag.

PDB Compounds: (A:) acidic fibroblast growth factor

SCOPe Domain Sequences for d1jqza1:

Sequence; same for both SEQRES and ATOM records:

>d1jqza1 b.42.1.1 (A:1G-137) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
fnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikste
tgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrg
prthygqkailflplpv

Timeline for d1jqza1:

• d1jqza1 first appeared in SCOP 1.59, called d1jqza_
  
• d1jqza1 appears in SCOPe 2.07