Lineage for d1jq5a_ (1jq5 A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3019289Fold e.22: Dehydroquinate synthase-like [56795] (1 superfamily)
    2 domains: (1) alpha/beta of a Rossmann-fold topology, binds NAD (2) multihelical array
  4. 3019290Superfamily e.22.1: Dehydroquinate synthase-like [56796] (3 families) (S)
  5. 3019320Family e.22.1.2: Iron-containing alcohol dehydrogenase [69892] (6 proteins)
    Pfam PF00465
  6. 3019328Protein Glycerol dehydrogenase [69893] (2 species)
  7. 3019329Species Bacillus stearothermophilus [TaxId:1422] [69894] (3 PDB entries)
  8. 3019330Domain d1jq5a_: 1jq5 A: [67084]
    complexed with nad, zn

Details for d1jq5a_

PDB Entry: 1jq5 (more details), 1.7 Å

PDB Description: bacillus stearothermophilus glycerol dehydrogenase complex with nad+
PDB Compounds: (A:) glycerol dehydrogenase

SCOPe Domain Sequences for d1jq5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jq5a_ e.22.1.2 (A:) Glycerol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]}
aaervfispakyvqgknvitkianylegignktvviadeivwkiaghtivnelkkgniaa
eevvfsgeasrneverianiarkaeaaivigvgggktldtakavadeldayivivptaas
tdaptsalsviysddgvfesyrfykknpdlvlvdtkiianapprllasgiadalatwvea
rsviksggktmaggiptiaaeaiaekceqtlfkygklayesvkakvvtpaleavveantl
lsglgfesgglaaahaihngftalegeihhlthgekvafgtlvqlaleehsqqeieryie
lylcldlpvtlediklkdasredilkvakaataegetihnafnvtaddvadaifaadqya
kaykek

SCOPe Domain Coordinates for d1jq5a_:

Click to download the PDB-style file with coordinates for d1jq5a_.
(The format of our PDB-style files is described here.)

Timeline for d1jq5a_: