Lineage for d1jq5a_ (1jq5 A:)

  1. Root: SCOP 1.59
  2. 140364Class e: Multi-domain proteins (alpha and beta) [56572] (34 folds)
  3. 141493Fold e.22: Dehydroquinate synthase-like [56795] (1 superfamily)
  4. 141494Superfamily e.22.1: Dehydroquinate synthase-like [56796] (2 families) (S)
  5. 141500Family e.22.1.2: Glycerol dehydrogenase [69892] (1 protein)
  6. 141501Protein Glycerol dehydrogenase [69893] (2 species)
  7. 141502Species Bacillus stearothermophilus [TaxId:1422] [69894] (3 PDB entries)
  8. 141503Domain d1jq5a_: 1jq5 A: [67084]

Details for d1jq5a_

PDB Entry: 1jq5 (more details), 1.7 Å

PDB Description: bacillus stearothermophilus glycerol dehydrogenase complex with nad+

SCOP Domain Sequences for d1jq5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jq5a_ e.22.1.2 (A:) Glycerol dehydrogenase {Bacillus stearothermophilus}
aaervfispakyvqgknvitkianylegignktvviadeivwkiaghtivnelkkgniaa
eevvfsgeasrneverianiarkaeaaivigvgggktldtakavadeldayivivptaas
tdaptsalsviysddgvfesyrfykknpdlvlvdtkiianapprllasgiadalatwvea
rsviksggktmaggiptiaaeaiaekceqtlfkygklayesvkakvvtpaleavveantl
lsglgfesgglaaahaihngftalegeihhlthgekvafgtlvqlaleehsqqeieryie
lylcldlpvtlediklkdasredilkvakaataegetihnafnvtaddvadaifaadqya
kaykek

SCOP Domain Coordinates for d1jq5a_:

Click to download the PDB-style file with coordinates for d1jq5a_.
(The format of our PDB-style files is described here.)

Timeline for d1jq5a_: