SCOP 1.73: Domain d1jq3a_: 1jq3 A:

Lineage for d1jq3a_ (1jq3 A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families)

5. Family c.66.1.17: Spermidine synthase [69557] (2 proteins)
   contains additional N-terminal tetramerisation all-beta domain, res. 1-71

6. Protein Spermidine synthase [69558] (6 species)
   polyamine aminopropyltransferase

7. Species Thermotoga maritima [TaxId:2336] [69559] (2 PDB entries)

8. Domain d1jq3a_: 1jq3 A: [67079]

Details for d1jq3a_

PDB Entry: 1jq3, 1.8 Å

PDB Description: Crystal Structure of Spermidine Synthase in Complex with Transition State Analogue AdoDATO

PDB Compounds: (A:) spermidine synthase

SCOP Domain Sequences for d1jq3a_:

Sequence; same for both SEQRES and ATOM records:

>d1jq3a_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]}
rtlkelerelqprqhlwyfeyytgnnvglfmkmnrviysgqsdiqridifenpdlgvvfa
ldgitmttekdefmyhemlahvpmflhpnpkkvliigggdggtlrevlkhdsvekailce
vdglvieaarkylkqtscgfddpraeiviangaeyvrkfknefdviiidstdptagqggh
lfteefyqacydalkedgvfsaetedpfydigwfklayrriskvfpitrvylgfmttyps
gmwsytfaskgidpikdfdpekvrkfnkelkyyneevhvasfalpnfvkkelglm

Timeline for d1jq3a_:

• d1jq3a_ first appeared in SCOP 1.59
  
• d1jq3a_ appears in SCOP 1.71
  
• d1jq3a_ appears in SCOP 1.75
  
• d1jq3a_ appears in the current release, SCOPe 2.08