Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species) VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species |
Species Engineered (including hybrid species) [88533] (60 PDB entries) SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # Humanized antibody ! SQ NA # humanized antibody ! SQ NA # engineered antibody |
Domain d1jpsl1: 1jps L:1-107 [67047] Other proteins in same PDB: d1jpsh1, d1jpsh2, d1jpsl2, d1jpst1, d1jpst2 part of humanized Fab D3H44 against human tissue factor |
PDB Entry: 1jps (more details), 1.85 Å
SCOPe Domain Sequences for d1jpsl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jpsl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} diqmtqspsslsasvgdrvtitcrasrdiksylnwyqqkpgkapkvliyyatslaegvps rfsgsgsgtdytltisslqpedfatyyclqhgespwtfgqgtkveik
Timeline for d1jpsl1:
View in 3D Domains from other chains: (mouse over for more information) d1jpsh1, d1jpsh2, d1jpst1, d1jpst2 |