PDB entry 1jps

View 1jps on RCSB PDB site
Description: Crystal structure of tissue factor in complex with humanized Fab D3h44
Class: immune system
Keywords: antigen-antibody recognition, humanized antibody, blood coagulation, interface water molecules, IMMUNE SYSTEM
Deposited on 2001-08-03, released 2002-02-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: immunoglobulin Fab D3H44, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1JPS (0-End)
    Domains in SCOPe 2.07: d1jpsh1, d1jpsh2
  • Chain 'L':
    Compound: immunoglobulin Fab D3h44, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1JPS (0-End)
    Domains in SCOPe 2.07: d1jpsl1, d1jpsl2
  • Chain 'T':
    Compound: tissue factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jpst1, d1jpst2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1jpsH (H:)
    evqlvesggglvqpggslrlscaasgfnikeyymhwvrqapgkglewvglidpeqgntiy
    dpkfqdratisadnskntaylqmnslraedtavyycardtaayfdywgqgtlvtvssast
    kgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
    slssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdktht
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jpsH (H:)
    evqlvesggglvqpggslrlscaasgfnikeyymhwvrqapgkglewvglidpeqgntiy
    dpkfqdratisadnskntaylqmnslraedtavyycardtaayfdywgqgtlvtvssast
    kgpsvfplapssggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslss
    vvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1jpsL (L:)
    diqmtqspsslsasvgdrvtitcrasrdiksylnwyqqkpgkapkvliyyatslaegvps
    rfsgsgsgtdytltisslqpedfatyyclqhgespwtfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jpsL (L:)
    diqmtqspsslsasvgdrvtitcrasrdiksylnwyqqkpgkapkvliyyatslaegvps
    rfsgsgsgtdytltisslqpedfatyyclqhgespwtfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1jpsT (T:)
    sgttntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdlt
    deivkdvkqtylarvfsypagnvestgsageplyenspeftpyletnlgqptiqsfeqvg
    tkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkktaktntneflidvd
    kgenycfsvqavipsrtvnrkstdspvecmgqekgefre
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jpsT (T:)
    ntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeiv
    kdvkqtylarvfsypagnveplyenspeftpyletnlgqptiqsfeqvgtkvnvtveder
    tlvrrnntflslrdvfgkdliytlyywkssssgkktaktntneflidvdkgenycfsvqa
    vipsrtvnrkstdspvecmg