Lineage for d1jpdx1 (1jpd X:114-321)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 235645Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 237406Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this family
  5. 237437Family c.1.11.2: D-glucarate dehydratase-like [51609] (7 proteins)
  6. 237480Protein L-Ala-D/L-Glu epimerase [69397] (2 species)
  7. 237486Species Escherichia coli [TaxId:562] [69398] (1 PDB entry)
  8. 237487Domain d1jpdx1: 1jpd X:114-321 [67014]
    Other proteins in same PDB: d1jpdx2
    structural genomics protein; mutant

Details for d1jpdx1

PDB Entry: 1jpd (more details), 2.6 Å

PDB Description: L-Ala-D/L-Glu Epimerase

SCOP Domain Sequences for d1jpdx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jpdx1 c.1.11.2 (X:114-321) L-Ala-D/L-Glu epimerase {Escherichia coli}
tlpetvitaqtvvigtpdqmansastlwqagakllkvkldnhlisermvairtavpdatl
ivdaneswraeglaarcqlladlgvamleqplpaqddaalenfihplpicadeschtrsn
lkalkgryemvnikldktggltealalatearaqgfslmlgcmlctsraisaalplvpqv
sfadldgptwlavdvepalqfttgelhl

SCOP Domain Coordinates for d1jpdx1:

Click to download the PDB-style file with coordinates for d1jpdx1.
(The format of our PDB-style files is described here.)

Timeline for d1jpdx1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jpdx2