Lineage for d1jowa2 (1jow A:149-254)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1091941Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 1091942Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
    duplication: consists of two domains of this fold
  5. 1091943Family a.74.1.1: Cyclin [47955] (8 proteins)
  6. 1092231Protein Viral cyclin [47961] (3 species)
  7. 1092232Species Herpesvirus saimiri [TaxId:10381] [47962] (5 PDB entries)
  8. 1092242Domain d1jowa2: 1jow A:149-254 [66999]
    Other proteins in same PDB: d1jowb_

Details for d1jowa2

PDB Entry: 1jow (more details), 3.1 Å

PDB Description: Crystal structure of a complex of human CDK6 and a viral cyclin
PDB Compounds: (A:) cyclin homolog

SCOPe Domain Sequences for d1jowa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jowa2 a.74.1.1 (A:149-254) Viral cyclin {Herpesvirus saimiri [TaxId: 10381]}
avlatdfliplcnalkipedlwpqlyeaasttickaliqpniallspglicaggllttie
tdntncrpwtcyledlssilnfstntvrtvkdqvseafslydleil

SCOPe Domain Coordinates for d1jowa2:

Click to download the PDB-style file with coordinates for d1jowa2.
(The format of our PDB-style files is described here.)

Timeline for d1jowa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jowa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1jowb_