SCOPe 2.01: Domain d1jn5b_: 1jn5 B:

Lineage for d1jn5b_ (1jn5 B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.2: NTF2-like [54431] (6 proteins)

6. Protein NTF2-like domain of Tip associating protein, TAP [69677] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69678] (2 PDB entries)

8. Domain d1jn5b_: 1jn5 B: [66922]
   Other proteins in same PDB: d1jn5a_

Details for d1jn5b_

PDB Entry: 1jn5, 2.8 Å

PDB Description: Structural basis for the recognition of a nucleoporin FG-repeat by the NTF2-like domain of TAP-p15 mRNA export factor

PDB Compounds: (B:) tap

SCOPe Domain Sequences for d1jn5b_:

Sequence, based on SEQRES records:

>d1jn5b_ d.17.4.2 (B:) NTF2-like domain of Tip associating protein, TAP {Human (Homo sapiens) [TaxId: 9606]}
appckgsyfgtenlkslvlhflqqyyaiydsgdrqglldayhdgaccslsipfipqnpar
sslaeyfkdsrnvkklkdptlrfrllkhtrlnvvaflnelpktqhdvnsfvvdisaqtst
llcfsvngvfkevdgksrdslraftrtfiavpasnsglcivndelfvrnasseeiqrafa
mpaptp

Sequence, based on observed residues (ATOM records):

>d1jn5b_ d.17.4.2 (B:) NTF2-like domain of Tip associating protein, TAP {Human (Homo sapiens) [TaxId: 9606]}
appckgsyfgtenlkslvlhflqqyyaiydsgdrqglldayhdgaccslsipfiarssla
eyfkdsrnvkklkdptlrfrllkhtrlnvvaflnelpktqhdvnsfvvdisaqtstllcf
svngvfkevdgksrdslraftrtfiavpasnsglcivndelfvrnasseeiqrafampap
tp

Timeline for d1jn5b_:

• d1jn5b_ first appeared in SCOP 1.59
  
• d1jn5b_ appears in SCOP 1.75
  
• d1jn5b_ appears in SCOPe 2.02
  
• d1jn5b_ appears in the current release, SCOPe 2.08, called d1jn5b1