Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
Family c.26.2.4: Universal stress protein-like [52436] (8 proteins) Pfam PF00582 |
Protein Universal stress protein A, UspA [69461] (1 species) |
Species Haemophilus influenzae [TaxId:727] [69462] (1 PDB entry) the nucleotide-binding is not known |
Domain d1jmva_: 1jmv A: [66897] structural genomics complexed with so4 |
PDB Entry: 1jmv (more details), 1.85 Å
SCOPe Domain Sequences for d1jmva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jmva_ c.26.2.4 (A:) Universal stress protein A, UspA {Haemophilus influenzae [TaxId: 727]} mykhilvavdlseespillkkavgiakrhdaklsiihvdvnfsdlytglidvnmssmqdr istetqkalldlaesvdypiseklsgsgdlgqvlsdaieqydvdllvtghhqdfwsklms strqvmntikidmlvvplrd
Timeline for d1jmva_: