SCOPe 2.06: Domain d1jmug_: 1jmu G:

Lineage for d1jmug_ (1jmu G:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.196: Outer capsid protein sigma 3 [64464] (1 superfamily)
   unusual fold

4. Superfamily d.196.1: Outer capsid protein sigma 3 [64465] (1 family)
   automatically mapped to Pfam PF00979

5. Family d.196.1.1: Outer capsid protein sigma 3 [64466] (1 protein)

6. Protein Outer capsid protein sigma 3 [64467] (1 species)

7. Species Reovirus [TaxId:10891] [64468] (3 PDB entries)

8. Domain d1jmug_: 1jmu G: [66894]
   Other proteins in same PDB: d1jmu.1, d1jmu.2, d1jmu.3
   complexed with bog, cl, so4, zn

Details for d1jmug_

PDB Entry: 1jmu, 2.8 Å

PDB Description: crystal structure of the reovirus mu1/sigma3 complex

PDB Compounds: (G:) sigma 3 protein

SCOPe Domain Sequences for d1jmug_:

Sequence; same for both SEQRES and ATOM records:

>d1jmug_ d.196.1.1 (G:) Outer capsid protein sigma 3 {Reovirus [TaxId: 10891]}
mevclpnghqivdlinnafegrvsiysaqegwdktisaqpdmmvcggavvcmhclgvvgs
lqrklkhlphhrcnqqirhqdyvdvqfadrvtahwkrgmlsfvcqmhammndvspedldr
vrteggslvelnwlqvdpnsmfrsihsswtdplqvvddldtkldqywtalnlmidssdlv
pnfmmrdpshafngvrlegdarqtqfsrtfdsrsslewgvmvydyselehdpskgrayrk
elvtpardfghfglshysrattpilgkmpavfsgmltgnckmypfikgtaklktvrklvd
svnhawgvekiryalgpggmtgwynrtmqqapivltpaaltmfsdttkfgdldypvmigd
pmilg

Timeline for d1jmug_:

• d1jmug_ first appeared in SCOP 1.59
  
• d1jmug_ appears in SCOPe 2.05
  
• d1jmug_ appears in SCOPe 2.07
  
• d1jmug_ appears in the current release, SCOPe 2.08