Lineage for d1jl2a_ (1jl2 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1606596Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1606597Family c.55.3.1: Ribonuclease H [53099] (5 proteins)
  6. 1606773Protein RNase H (RNase HI) [53100] (4 species)
  7. 1606830Species synthetic, Escherichia coli/Thermus thermophilus chimera [69532] (1 PDB entry)
  8. 1606831Domain d1jl2a_: 1jl2 A: [66822]

Details for d1jl2a_

PDB Entry: 1jl2 (more details), 1.76 Å

PDB Description: crystal structure of tceo rnase h-a chimera combining the folding core from t. thermophilus rnase h and the remaining region of e. coli rnase h
PDB Compounds: (A:) chimeric RNase H

SCOPe Domain Sequences for d1jl2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jl2a_ c.55.3.1 (A:) RNase H (RNase HI) {synthetic, Escherichia coli/Thermus thermophilus chimera}
kqveiftdgsalgnpgpggygailryrgrektfsagytrttnnrmelkaaieglkalkep
aevdlytdshylkkaftegwlegwrkrgwrtaegkpvknrdlwealllamaphrvrfhfv
kghaghpeneradelaraaamnptledtgy

SCOPe Domain Coordinates for d1jl2a_:

Click to download the PDB-style file with coordinates for d1jl2a_.
(The format of our PDB-style files is described here.)

Timeline for d1jl2a_: