SCOP 1.75: Domain d1jkya2: 1jky A:551-776

Lineage for d1jkya2 (1jky A:551-776)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (17 families)

5. Family d.92.1.14: Anthrax toxin lethal factor, N- and C-terminal domains [69775] (1 protein)

6. Protein Anthrax toxin lethal factor, N- and C-terminal domains [69776] (1 species)
   duplication: each domain adopts a thermolysin-like fold, but the proteolytic activity resides only in the C-terminal domain

7. Species Bacillus anthracis [TaxId:1392] [69777] (9 PDB entries)

8. Domain d1jkya2: 1jky A:551-776 [66818]
   Other proteins in same PDB: d1jkya3
   complexed with the n-terminal peptide of mapkk2

Details for d1jkya2

PDB Entry: 1jky, 3.9 Å

PDB Description: crystal structure of the anthrax lethal factor (lf): wild-type lf complexed with the n-terminal sequence of mapkk2

PDB Compounds: (A:) Lethal Factor

SCOP Domain Sequences for d1jkya2:

Sequence; same for both SEQRES and ATOM records:

>d1jkya2 d.92.1.14 (A:551-776) Anthrax toxin lethal factor, N- and C-terminal domains {Bacillus anthracis [TaxId: 1392]}
pkskidtkiqeaqlninqewnkalglpkytklitfnvhnryasnivesaylilnewknni
qsdlikkvtnylvdgngrfvftditlpniaeqythqdeiyeqvhskglyvpesrsillhg
pskgvelrndsegfihefghavddyagylldknqsdlvtnskkfidifkeegsnltsygr
tneaeffaeafrlmhstdhaerlkvqknapktfqfindqikfiins

Timeline for d1jkya2:

• d1jkya2 first appeared in SCOP 1.59
  
• d1jkya2 appears in SCOP 1.73
  
• d1jkya2 appears in SCOPe 2.01
  
• d1jkya2 appears in the current release, SCOPe 2.08