![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.14: Anthrax toxin lethal factor, N- and C-terminal domains [69775] (2 proteins) automatically mapped to Pfam PF07737 |
![]() | Protein Anthrax toxin lethal factor, N- and C-terminal domains [69776] (1 species) duplication: each domain adopts a thermolysin-like fold, but the proteolytic activity resides only in the C-terminal domain |
![]() | Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [69777] (9 PDB entries) |
![]() | Domain d1jkya2: 1jky A:551-776 [66818] Other proteins in same PDB: d1jkya3 complexed with the n-terminal peptide of mapkk2 |
PDB Entry: 1jky (more details), 3.9 Å
SCOPe Domain Sequences for d1jkya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jkya2 d.92.1.14 (A:551-776) Anthrax toxin lethal factor, N- and C-terminal domains {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} pkskidtkiqeaqlninqewnkalglpkytklitfnvhnryasnivesaylilnewknni qsdlikkvtnylvdgngrfvftditlpniaeqythqdeiyeqvhskglyvpesrsillhg pskgvelrndsegfihefghavddyagylldknqsdlvtnskkfidifkeegsnltsygr tneaeffaeafrlmhstdhaerlkvqknapktfqfindqikfiins
Timeline for d1jkya2: