SCOP 1.61: Domain d1jhkl2: 1jhk L:108-213

Lineage for d1jhkl2 (1jhk L:108-213)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)

7. Species Anti-estradiol Fab 57-2, (mouse), kappa L chain [69149] (2 PDB entries)

8. Domain d1jhkl2: 1jhk L:108-213 [66718]
   Other proteins in same PDB: d1jhkh1, d1jhkl1

Details for d1jhkl2

PDB Entry: 1jhk, 2.51 Å

PDB Description: Crystal structure of the anti-estradiol antibody 57-2

SCOP Domain Sequences for d1jhkl2:

Sequence; same for both SEQRES and ATOM records:

>d1jhkl2 b.1.1.2 (L:108-213) Immunoglobulin (constant domains of L and H chains) {Anti-estradiol Fab 57-2, (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d1jhkl2:

• d1jhkl2 first appeared in SCOP 1.59
  
• d1jhkl2 appears in SCOP 1.63
  
• d1jhkl2 appears in the current release, SCOPe 2.08