Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species) |
Species Anti-estradiol Fab 57-2, (mouse), kappa L chain [69149] (2 PDB entries) |
Domain d1jhkl2: 1jhk L:108-213 [66718] Other proteins in same PDB: d1jhkh1, d1jhkl1 |
PDB Entry: 1jhk (more details), 2.51 Å
SCOP Domain Sequences for d1jhkl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jhkl2 b.1.1.2 (L:108-213) Immunoglobulin (constant domains of L and H chains) {Anti-estradiol Fab 57-2, (mouse), kappa L chain} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrne
Timeline for d1jhkl2: