SCOPe 2.08: Domain d1jhkh1: 1jhk H:2-113

Lineage for d1jhkh1 (1jhk H:2-113)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88554] (34 PDB entries)
   Uniprot P06327 20-117 # HV52_MOUSE (P06327) Ig heavy chain V region VH558 A1/A4 precursor; 57% sequence identity ! Uniprot P01631 # KV2G_MOUSE (P01631) Ig kappa chain V-II region 26-10

8. Domain d1jhkh1: 1jhk H:2-113 [66715]
   Other proteins in same PDB: d1jhkh2, d1jhkl1, d1jhkl2
   part of anti-estradiol Fab 57-2

Details for d1jhkh1

PDB Entry: 1jhk, 2.51 Å

PDB Description: Crystal structure of the anti-estradiol antibody 57-2

PDB Compounds: (H:) Ig gamma-1-chain

SCOPe Domain Sequences for d1jhkh1:

Sequence, based on SEQRES records:

>d1jhkh1 b.1.1.1 (H:2-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
iqlvqsgpelkkpgetvrisckasdysfmtsgmqwvqqmpgkglkwigwlntqsgvpeya
edfkgrfafsletsattaylqinnlknedtatyfcatwggnsaywgqgttltvss

Sequence, based on observed residues (ATOM records):

>d1jhkh1 b.1.1.1 (H:2-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
iqlvqsgpelkkpgetvrisckasdytsgmqwvqqmpgkglkwigwlntqsgvpeyaedf
kgrfafslettaylqinnlknedtatyfcatwggnsaywgqgttltvss

Timeline for d1jhkh1:

• d1jhkh1 first appeared in SCOP 1.59
  
• d1jhkh1 appears in SCOPe 2.07