PDB entry 1jhk

View 1jhk on RCSB PDB site
Description: Crystal structure of the anti-estradiol antibody 57-2
Class: immune system
Keywords: antibody, steroid, IMMUNE SYSTEM
Deposited on 2001-06-28, released 2001-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: 0.198
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Ig gamma-1-chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1jhkh1, d1jhkh2
  • Chain 'L':
    Compound: Ig kappa-chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VCP0 (0-End)
      • see remark 999 (117)
    Domains in SCOPe 2.07: d1jhkl1, d1jhkl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1jhkH (H:)
    qiqlvqsgpelkkpgetvrisckasdysfmtsgmqwvqqmpgkglkwigwlntqsgvpey
    aedfkgrfafsletsattaylqinnlknedtatyfcatwggnsaywgqgttltvssaktt
    ppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
    sssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jhkH (H:)
    iqlvqsgpelkkpgetvrisckasdytsgmqwvqqmpgkglkwigwlntqsgvpeyaedf
    kgrfafslettaylqinnlknedtatyfcatwggnsaywgqgttltvssakttppsvypl
    apgtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvtvpsstw
    psetvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1jhkL (L:)
    diqmtqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvynaktladgvps
    rfsgsgsgtqyslkinslqpedfgtyychhfwstpwtfgggtklevkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1jhkL (L:)
    diqmtqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvynaktladgvps
    rfsgsgsgtqyslkinslqpedfgtyychhfwstpwtfgggtklevkradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne