Lineage for d1jh9a2 (1jh9 A:59-340)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) 
Family c.93.1.1: L-arabinose binding protein-like [53823] (13 proteins) 
Protein Purine repressor (PurR), C-terminal domain [53835] (1 species) Species Escherichia coli [TaxId:562] [53836] (24 PDB entries) 
Domain d1jh9a2: 1jh9 A:59-340 [66711]
Other proteins in same PDB: d1jh9a1
Details for d1jh9a2
PDB Entry: 1jh9 (more details), 2.55 Å
PDB Description: purine repressor mutant-hypoxanthine-purf operator complex
SCOP Domain Sequences for d1jh9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jh9a2 c.93.1.1 (A:59-340) Purine repressor (PurR), C-terminal domain {Escherichia coli}
tksigllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdg
llvmcseypepllamleeyrhipmvvmdrgeakadftdavidnafeggymagryliergh
reigvipgplerntgagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqph
rptavfcggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslg
etafnmlldrivnkreepqsievhprlierrsvadgpfrdyr
SCOP Domain Coordinates for d1jh9a2:
Click to download the PDB-style file with coordinates for d1jh9a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jh9a2:
- d1jh9a2 first appeared in SCOP 1.59
- d1jh9a2 appears in SCOP 1.63
- d1jh9a2 appears in the current release, SCOPe 2.08
View in 3D
