SCOP 1.71: Domain d1jgvh1: 1jgv H:1-113

Lineage for d1jgvh1 (1jgv H:1-113)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2.1 [TaxId:10090] [88549] (16 PDB entries)

8. Domain d1jgvh1: 1jgv H:1-113 [66692]
   Other proteins in same PDB: d1jgvh2, d1jgvl1, d1jgvl2
   part of catalytic Fab 1D4

Details for d1jgvh1

PDB Entry: 1jgv, 1.85 Å

PDB Description: structural basis for disfavored elimination reaction in catalytic antibody 1d4

SCOP Domain Sequences for d1jgvh1:

Sequence; same for both SEQRES and ATOM records:

>d1jgvh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.1}
evklvesrgglvkpggslqlscaasgftfsgyamswfrltpekrlewvasiyngfrihyl
dsvkgrftissdyarnilylqmstlrsedtamyycsrgdaysryfdvwgagttvtvsa

Timeline for d1jgvh1:

• d1jgvh1 first appeared in SCOP 1.59
  
• d1jgvh1 appears in SCOP 1.69
  
• d1jgvh1 appears in SCOP 1.73
  
• d1jgvh1 appears in the current release, SCOPe 2.08