| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
| Family a.104.1.1: Cytochrome P450 [48265] (23 proteins) |
| Protein Cytochrome P450-NOR, nitric reductase [48270] (1 species) |
| Species Fungus (Fusarium oxysporum) [TaxId:5507] [48271] (18 PDB entries) Uniprot P23295 |
| Domain d1jfba_: 1jfb A: [66624] complexed with gol, hem |
PDB Entry: 1jfb (more details), 1 Å
SCOPe Domain Sequences for d1jfba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]}
apsfpfsrasgpeppaefaklratnpvsqvklfdgslawlvtkhkdvcfvatseklskvr
trqgfpelsasgkqaakakptfvdmdppehmhqrsmveptftpeavknlqpyiqrtvddl
leqmkqkgcangpvdlvkefalpvpsyiiytllgvpfndleyltqqnairtngsstarea
saanqelldylailveqrlvepkddiisklcteqvkpgnidksdavqiaflllvagnatm
vnmialgvatlaqhpdqlaqlkanpslapqfveelcryhtasalaikrtakedvmigdkl
vranegiiasnqsanrdeevfenpdefnmnrkwppqdplgfgfgdhrciaehlakaeltt
vfstlyqkfpdlkvavplgkinytplnrdvgivdlpvif
Timeline for d1jfba_: