Lineage for d1jfaa_ (1jfa A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1504321Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 1504322Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 1504554Family a.128.1.5: Trichodiene synthase [69113] (1 protein)
    automatically mapped to Pfam PF06330
  6. 1504555Protein Trichodiene synthase [69114] (1 species)
  7. 1504556Species Fusarium sporotrichioides [TaxId:5514] [69115] (20 PDB entries)
  8. 1504571Domain d1jfaa_: 1jfa A: [66622]
    complexed with edo

Details for d1jfaa_

PDB Entry: 1jfa (more details), 2.5 Å

PDB Description: Trichodiene Synthase from Fusarium Sporotrichioides
PDB Compounds: (A:) trichodiene synthase

SCOPe Domain Sequences for d1jfaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jfaa_ a.128.1.5 (A:) Trichodiene synthase {Fusarium sporotrichioides [TaxId: 5514]}
menfpteyflnttvrlleyiryrdsnytreerienlhyaynkaahhfaqprqqqllkvdp
krlqaslqtivgmvvyswakvskecmadlsihytytlvlddskddpyptmvnyfddlqag
reqahpwwalvnehfpnvlrhfgpfcslnlirstldffegcwieqynfggfpgshdypqf
lrrmnglghcvgaslwpkeqfnerslfleitsaiaqmenwmvwvndlmsfykefdderdq
islvknyvvsdeislhealekltqdtlhsskqmvavfsdkdpqvmdtiecfmhgyvtwhl
cdrryrlseiyekvkeektedaqkfckfyeqaanvgavspsewayppvaqlanv

SCOPe Domain Coordinates for d1jfaa_:

Click to download the PDB-style file with coordinates for d1jfaa_.
(The format of our PDB-style files is described here.)

Timeline for d1jfaa_: