Lineage for d1jf7b_ (1jf7 B:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (2 families) 
Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (3 proteins) Protein Tyrosine phosphatase [52806] (7 species) Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (28 PDB entries) 
Domain d1jf7b_: 1jf7 B: [66620]
Details for d1jf7b_
PDB Entry: 1jf7 (more details), 2.2 Å
PDB Description: human ptp1b catalytic domain complexed with pnu177836
SCOP Domain Sequences for d1jf7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jf7b_ c.45.1.2 (B:) Tyrosine phosphatase {Human (Homo sapiens), 1B}
emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc
aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd
fgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdp
ssvdikkvllemrkfrmgliqtadqlrfsylaviegakfim
SCOP Domain Coordinates for d1jf7b_:
Click to download the PDB-style file with coordinates for d1jf7b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jf7b_:
- d1jf7b_ is new in SCOP 1.59
- d1jf7b_ appears in SCOP 1.61
- d1jf7b_ appears in the current release, SCOPe 2.08
View in 3D
